Anti RHPN1 pAb (ATL-HPA024671)

Atlas Antibodies

Catalog No.: ATL-HPA024671-25

Protein Description: rhophilin, Rho GTPase binding protein 1
Gene Name: RHPN1
Alternative Gene Name: KIAA1929, ODF5, RHPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022580: 77%, ENSRNOG00000007597: 73%
Entrez Gene ID: 114822
Uniprot ID: Q8TCX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE
• Gene Sequence: AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE
• Gene ID - Mouse: ENSMUSG00000022580
• Gene ID - Rat: ENSRNOG00000007597
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.