Anti RHPN1 pAb (ATL-HPA024671)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024671-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RHPN1
Alternative Gene Name: KIAA1929, ODF5, RHPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022580: 77%, ENSRNOG00000007597: 73%
Entrez Gene ID: 114822
Uniprot ID: Q8TCX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE |
| Gene Sequence | AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE |
| Gene ID - Mouse | ENSMUSG00000022580 |
| Gene ID - Rat | ENSRNOG00000007597 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RHPN1 pAb (ATL-HPA024671) | |
| Datasheet | Anti RHPN1 pAb (ATL-HPA024671) Datasheet (External Link) |
| Vendor Page | Anti RHPN1 pAb (ATL-HPA024671) at Atlas Antibodies |
| Documents & Links for Anti RHPN1 pAb (ATL-HPA024671) | |
| Datasheet | Anti RHPN1 pAb (ATL-HPA024671) Datasheet (External Link) |
| Vendor Page | Anti RHPN1 pAb (ATL-HPA024671) |