Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043615-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ral guanine nucleotide dissociation stimulator-like 3
Gene Name: RGL3
Alternative Gene Name: FLJ32585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040146: 74%, ENSRNOG00000013027: 74%
Entrez Gene ID: 57139
Uniprot ID: Q3MIN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED
Gene Sequence VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED
Gene ID - Mouse ENSMUSG00000040146
Gene ID - Rat ENSRNOG00000013027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation)
Datasheet Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation)
Datasheet Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGL3 pAb (ATL-HPA043615 w/enhanced validation)