Anti RFC5 pAb (ATL-HPA041037)

Atlas Antibodies

Catalog No.: ATL-HPA041037-25

Protein Description: replication factor C (activator 1) 5, 36.5kDa
Gene Name: RFC5
Alternative Gene Name: RFC36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029363: 97%, ENSRNOG00000001134: 97%
Entrez Gene ID: 5985
Uniprot ID: P40937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI
• Gene Sequence: NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI
• Gene ID - Mouse: ENSMUSG00000029363
• Gene ID - Rat: ENSRNOG00000001134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.