Anti RFC2 pAb (ATL-HPA029493)

Atlas Antibodies

Catalog No.: ATL-HPA029493-100

Protein Description: replication factor C (activator 1) 2, 40kDa
Gene Name: RFC2
Alternative Gene Name: A1, RFC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023104: 90%, ENSRNOG00000001457: 90%
Entrez Gene ID: 5982
Uniprot ID: P35250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND
• Gene Sequence: PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND
• Gene ID - Mouse: ENSMUSG00000023104
• Gene ID - Rat: ENSRNOG00000001457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.