Anti RERG pAb (ATL-HPA041387)

Atlas Antibodies

Catalog No.:
ATL-HPA041387-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS-like, estrogen-regulated, growth inhibitor
Gene Name: RERG
Alternative Gene Name: MGC15754
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030222: 98%, ENSRNOG00000027592: 98%
Entrez Gene ID: 85004
Uniprot ID: Q96A58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNK
Gene Sequence TAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNK
Gene ID - Mouse ENSMUSG00000030222
Gene ID - Rat ENSRNOG00000027592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RERG pAb (ATL-HPA041387)
Datasheet Anti RERG pAb (ATL-HPA041387) Datasheet (External Link)
Vendor Page Anti RERG pAb (ATL-HPA041387) at Atlas Antibodies

Documents & Links for Anti RERG pAb (ATL-HPA041387)
Datasheet Anti RERG pAb (ATL-HPA041387) Datasheet (External Link)
Vendor Page Anti RERG pAb (ATL-HPA041387)