Anti RELB pAb (ATL-HPA040506)

Atlas Antibodies

Catalog No.: ATL-HPA040506-25

Protein Description: v-rel avian reticuloendotheliosis viral oncogene homolog B
Gene Name: RELB
Alternative Gene Name: REL-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002983: 97%, ENSRNOG00000033235: 97%
Entrez Gene ID: 5971
Uniprot ID: Q01201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ
• Gene Sequence: WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ
• Gene ID - Mouse: ENSMUSG00000002983
• Gene ID - Rat: ENSRNOG00000033235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RELB pAb (ATL-HPA040506) – 1 Found

Di Pompo, Gemma; Cortini, Margherita; Palomba, Roberto; Di Francesco, Valentina; Bellotti, Elena; Decuzzi, Paolo; Baldini, Nicola; Avnet, Sofia. Curcumin-Loaded Nanoparticles Impair the Pro-Tumor Activity of Acid-Stressed MSC in an In Vitro Model of Osteosarcoma. International Journal Of Molecular Sciences. 2021;22(11)