Anti REC8 pAb (ATL-HPA031729)

Atlas Antibodies

Catalog No.: ATL-HPA031729-25

Protein Description: REC8 meiotic recombination protein
Gene Name: REC8
Alternative Gene Name: kleisin-alpha, REC8L1, Rec8p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002324: 72%, ENSRNOG00000019503: 76%
Entrez Gene ID: 9985
Uniprot ID: O95072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
• Gene Sequence: PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP
• Gene ID - Mouse: ENSMUSG00000002324
• Gene ID - Rat: ENSRNOG00000019503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti REC8 pAb (ATL-HPA031729) – 1 Found

Lindsey, Scott F; Byrnes, Diana M; Eller, Mark S; Rosa, Ashley M; Dabas, Nitika; Escandon, Julia; Grichnik, James M. Potential role of meiosis proteins in melanoma chromosomal instability. Journal Of Skin Cancer. 2013( 23840955):190109.