Anti RDM1 pAb (ATL-HPA024794 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024794-25

Protein Description: RAD52 motif containing 1
Gene Name: RDM1
Alternative Gene Name: MGC33977, RAD52B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010362: 71%, ENSRNOG00000020751: 70%
Entrez Gene ID: 201299
Uniprot ID: Q8NG50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVE
• Gene Sequence: SPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVE
• Gene ID - Mouse: ENSMUSG00000010362
• Gene ID - Rat: ENSRNOG00000020751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RDM1 pAb (ATL-HPA024794 w/enhanced validation) – 1 Found

Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266)