Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038474-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RCN1
Alternative Gene Name: FLJ37041, PIG20, Rcal, RCN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005973: 92%, ENSRNOG00000013452: 92%
Entrez Gene ID: 5954
Uniprot ID: Q15293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA |
| Gene Sequence | LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA |
| Gene ID - Mouse | ENSMUSG00000005973 |
| Gene ID - Rat | ENSRNOG00000013452 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) | |
| Datasheet | Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) | |
| Datasheet | Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RCN1 pAb (ATL-HPA038474 w/enhanced validation) |