Anti RCHY1 pAb (ATL-HPA030339)

Atlas Antibodies

Catalog No.: ATL-HPA030339-25

Protein Description: ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase
Gene Name: RCHY1
Alternative Gene Name: ARNIP, CHIMP, DKFZp586C1620, PIRH2, PRO1996, RNF199, ZCHY, ZNF363
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029397: 91%, ENSRNOG00000002546: 94%
Entrez Gene ID: 25898
Uniprot ID: Q96PM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
• Gene Sequence: CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
• Gene ID - Mouse: ENSMUSG00000029397
• Gene ID - Rat: ENSRNOG00000002546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RCHY1 pAb (ATL-HPA030339) – 2 Found

Foo, Lynette C. Cyclin-dependent kinase 9 is required for the survival of adult Drosophila melanogaster glia. Scientific Reports. 2017;7(1):6796. 

Foo, Lynette Caizhen; Song, Shilin; Cohen, Stephen Michael. miR-31 mutants reveal continuous glial homeostasis in the adult Drosophila brain. The Embo Journal. 2017;36(9):1215-1226.