Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027573-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: regulator of chromosome condensation 1
Gene Name: RCC1
Alternative Gene Name: CHC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028896: 90%, ENSRNOG00000050106: 90%
Entrez Gene ID: 1104
Uniprot ID: P18754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Gene Sequence IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Gene ID - Mouse ENSMUSG00000028896
Gene ID - Rat ENSRNOG00000050106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation)
Datasheet Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation)
Datasheet Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RCC1 pAb (ATL-HPA027573 w/enhanced validation)