Anti RCBTB2 pAb (ATL-HPA040242)

Atlas Antibodies

Catalog No.: ATL-HPA040242-100

Protein Description: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Gene Name: RCBTB2
Alternative Gene Name: CHC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022106: 93%, ENSRNOG00000015054: 92%
Entrez Gene ID: 1102
Uniprot ID: O95199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG
• Gene Sequence: SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG
• Gene ID - Mouse: ENSMUSG00000022106
• Gene ID - Rat: ENSRNOG00000015054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.