Anti RCBTB2 pAb (ATL-HPA040242)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040242-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: RCBTB2
Alternative Gene Name: CHC1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022106: 93%, ENSRNOG00000015054: 92%
Entrez Gene ID: 1102
Uniprot ID: O95199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG |
| Gene Sequence | SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG |
| Gene ID - Mouse | ENSMUSG00000022106 |
| Gene ID - Rat | ENSRNOG00000015054 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCBTB2 pAb (ATL-HPA040242) | |
| Datasheet | Anti RCBTB2 pAb (ATL-HPA040242) Datasheet (External Link) |
| Vendor Page | Anti RCBTB2 pAb (ATL-HPA040242) at Atlas Antibodies |
| Documents & Links for Anti RCBTB2 pAb (ATL-HPA040242) | |
| Datasheet | Anti RCBTB2 pAb (ATL-HPA040242) Datasheet (External Link) |
| Vendor Page | Anti RCBTB2 pAb (ATL-HPA040242) |