Anti RBP7 pAb (ATL-HPA034749 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034749-25

Protein Description: retinol binding protein 7, cellular
Gene Name: RBP7
Alternative Gene Name: CRBPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028996: 85%, ENSRNOG00000015850: 82%
Entrez Gene ID: 116362
Uniprot ID: Q96R05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
• Gene Sequence: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
• Gene ID - Mouse: ENSMUSG00000028996
• Gene ID - Rat: ENSRNOG00000015850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBP7 pAb (ATL-HPA034749 w/enhanced validation) – 1 Found

Elmasry, Manal; Brandl, Lydia; Engel, Jutta; Jung, Andreas; Kirchner, Thomas; Horst, David. RBP7 is a clinically prognostic biomarker and linked to tumor invasion and EMT in colon cancer. Journal Of Cancer. 10(20):4883-4891.