Anti RBM48 pAb (ATL-HPA021777)

Atlas Antibodies

Catalog No.: ATL-HPA021777-25

Protein Description: RNA binding motif protein 48
Gene Name: RBM48
Alternative Gene Name: C7orf64, DKFZp564O0523, HSPC304
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040302: 73%, ENSRNOG00000008980: 75%
Entrez Gene ID: 84060
Uniprot ID: Q5RL73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF
• Gene Sequence: MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF
• Gene ID - Mouse: ENSMUSG00000040302
• Gene ID - Rat: ENSRNOG00000008980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.