Anti RBM42 pAb (ATL-HPA043671)

Atlas Antibodies

Catalog No.:
ATL-HPA043671-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 42
Gene Name: RBM42
Alternative Gene Name: MGC10433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036733: 100%, ENSRNOG00000024278: 100%
Entrez Gene ID: 79171
Uniprot ID: Q9BTD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen MALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYG
Gene Sequence MALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYG
Gene ID - Mouse ENSMUSG00000036733
Gene ID - Rat ENSRNOG00000024278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM42 pAb (ATL-HPA043671)
Datasheet Anti RBM42 pAb (ATL-HPA043671) Datasheet (External Link)
Vendor Page Anti RBM42 pAb (ATL-HPA043671) at Atlas Antibodies

Documents & Links for Anti RBM42 pAb (ATL-HPA043671)
Datasheet Anti RBM42 pAb (ATL-HPA043671) Datasheet (External Link)
Vendor Page Anti RBM42 pAb (ATL-HPA043671)