Anti RBM3 pAb (ATL-HPA003624 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003624-25

Protein Description: RNA binding motif (RNP1, RRM) protein 3
Gene Name: RBM3
Alternative Gene Name: IS1-RNPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031167: 94%, ENSRNOG00000005387: 96%
Entrez Gene ID: 5935
Uniprot ID: P98179
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
• Gene Sequence: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
• Gene ID - Mouse: ENSMUSG00000031167
• Gene ID - Rat: ENSRNOG00000005387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM3 pAb (ATL-HPA003624 w/enhanced validation) – 6 Found

Kang, Sun Hee; Cho, Jihyoung; Jeong, Hasong; Kwon, Sun Young. High RNA-binding Motif Protein 3 Expression Is Associated with Improved Clinical Outcomes in Invasive Breast Cancer. Journal Of Breast Cancer. 2018;21(3):288-296. 

Grupp, Katharina; Hofmann, Bianca; Kutup, Asad; Bachmann, Kai; Bogoevski, Dean; Melling, Nathaniel; Uzunoglu, Faik Guntac; El Gammal, Alexander Tarek; Koop, Christina; Simon, Ronald; Steurer, Stefan; Krech, Till; Burdak-Rothkamm, Susanne; Jacobsen, Frank; Sauter, Guido; Izbicki, Jakob; Wilczak, Waldemar. Reduced RBM3 expression is associated with aggressive tumor features in esophageal cancer but not significantly linked to patient outcome. Bmc Cancer. 2018;18(1):1106. 

Jögi, Annika; Brennan, Donal J; Rydén, Lisa; Magnusson, Kristina; Fernö, Mårten; Stål, Olle; Borgquist, Signe; Uhlen, Mathias; Landberg, Göran; Påhlman, Sven; Pontén, Fredrik; Jirström, Karin. Nuclear expression of the RNA-binding protein RBM3 is associated with an improved clinical outcome in breast cancer. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2009;22(12):1564-74. 

Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35. 

Hjelm, Barbara; Brennan, Donal J; Zendehrokh, Nooreldin; Eberhard, Jakob; Nodin, Björn; Gaber, Alexander; Pontén, Fredrik; Johannesson, Henrik; Smaragdi, Kristina; Frantz, Christian; Hober, Sophia; Johnson, Louis B; Påhlman, Sven; Jirström, Karin; Uhlen, Mathias. High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer. Proteomics. Clinical Applications. 2011;5(11-12):624-35. 

Carleton, Neil M; Zhu, Guangjing; Miller, M Craig; Davis, Christine; Kulkarni, Prakash; Veltri, Robert W. Characterization of RNA-Binding Motif 3 (RBM3) Protein Levels and Nuclear Architecture Changes in Aggressive and Recurrent Prostate Cancer. Cancer Reports (Hoboken, N.j.). 2020;3(3):e1237.