Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037478-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 17
Gene Name: RBM17
Alternative Gene Name: MGC14439, SPF45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037197: 99%, ENSRNOG00000018767: 100%
Entrez Gene ID: 84991
Uniprot ID: Q96I25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVV
Gene Sequence SQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVV
Gene ID - Mouse ENSMUSG00000037197
Gene ID - Rat ENSRNOG00000018767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation)
Datasheet Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation)
Datasheet Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RBM17 pAb (ATL-HPA037478 w/enhanced validation)