Anti RBM14 pAb (ATL-HPA006628 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006628-100

Protein Description: RNA binding motif protein 14
Gene Name: RBM14
Alternative Gene Name: COAA, DKFZp779J0927, SIP, SYTIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006456: 98%, ENSRNOG00000045568: 98%
Entrez Gene ID: 10432
Uniprot ID: Q96PK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
• Gene Sequence: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
• Gene ID - Mouse: ENSMUSG00000006456
• Gene ID - Rat: ENSRNOG00000045568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM14 pAb (ATL-HPA006628 w/enhanced validation) – 1 Found

Qin, Hao; Qu, Yi; Yuan, Yi-Feng; Li, Yang-Yang; Qiao, Jie. RBM14 Modulates Tubulin Acetylation and Regulates Spindle Morphology During Meiotic Maturation in Mouse Oocytes. Frontiers In Cell And Developmental Biology. 9( 33604343):635728.