Anti RBM10 pAb (ATL-HPA034972 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034972-25

Protein Description: RNA binding motif protein 10
Gene Name: RBM10
Alternative Gene Name: DXS8237E, GPATC9, GPATCH9, KIAA0122, ZRANB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031060: 98%, ENSRNOG00000008472: 99%
Entrez Gene ID: 8241
Uniprot ID: P98175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR
• Gene Sequence: MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR
• Gene ID - Mouse: ENSMUSG00000031060
• Gene ID - Rat: ENSRNOG00000008472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM10 pAb (ATL-HPA034972 w/enhanced validation) – 6 Found

Zhao, Jiawei; Sun, Yue; Huang, Yin; Song, Fan; Huang, Zengshu; Bao, Yufang; Zuo, Ji; Saffen, David; Shao, Zhen; Liu, Wen; Wang, Yongbo. Functional analysis reveals that RBM10 mutations contribute to lung adenocarcinoma pathogenesis by deregulating splicing. Scientific Reports. 2017;7( 28091594):40488. 

Sun, Yue; Bao, Yufang; Han, Wenjian; Song, Fan; Shen, Xianfeng; Zhao, Jiawei; Zuo, Ji; Saffen, David; Chen, Wei; Wang, Zefeng; You, Xintian; Wang, Yongbo. Autoregulation of RBM10 and cross-regulation of RBM10/RBM5 via alternative splicing-coupled nonsense-mediated decay. Nucleic Acids Research. 2017;45(14):8524-8540. 

Loiselle, Julie J; Roy, Justin G; Sutherland, Leslie C. RBM10 promotes transformation-associated processes in small cell lung cancer and is directly regulated by RBM5. Plos One. 12(6):e0180258. 

Jackson, Travis C; Du, Lina; Janesko-Feldman, Keri; Vagni, Vincent A; Dezfulian, Cameron; Poloyac, Samuel M; Jackson, Edwin K; Clark, Robert S B; Kochanek, Patrick M. The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2015;35(4):655-66. 

Pozzi, Berta; Bragado, Laureano; Mammi, Pablo; Torti, María Florencia; Gaioli, Nicolás; Gebhard, Leopoldo G; García Solá, Martín E; Vaz-Drago, Rita; Iglesias, Néstor G; García, Cybele C; Gamarnik, Andrea V; Srebrow, Anabella. Dengue virus targets RBM10 deregulating host cell splicing and innate immune response. Nucleic Acids Research. 2020;48(12):6824-6838. 

Zhang, Sirui; Bao, Yufang; Shen, Xianfeng; Pan, Yunjian; Sun, Yue; Xiao, Man; Chen, Kexuan; Wei, Huanhuan; Zuo, Ji; Saffen, David; Zong, Wei-Xing; Sun, Yihua; Wang, Zefeng; Wang, Yongbo. RNA binding motif protein 10 suppresses lung cancer progression by controlling alternative splicing of eukaryotic translation initiation factor 4H. Ebiomedicine. 2020;61( 33130397):103067.