Anti RBFA pAb (ATL-HPA041479)

Atlas Antibodies

Catalog No.:
ATL-HPA041479-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribosome binding factor A (putative)
Gene Name: RBFA
Alternative Gene Name: C18orf22, FLJ21172, HsT169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024570: 42%, ENSRNOG00000055647: 48%
Entrez Gene ID: 79863
Uniprot ID: Q8N0V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYA
Gene Sequence DPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYA
Gene ID - Mouse ENSMUSG00000024570
Gene ID - Rat ENSRNOG00000055647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBFA pAb (ATL-HPA041479)
Datasheet Anti RBFA pAb (ATL-HPA041479) Datasheet (External Link)
Vendor Page Anti RBFA pAb (ATL-HPA041479) at Atlas Antibodies

Documents & Links for Anti RBFA pAb (ATL-HPA041479)
Datasheet Anti RBFA pAb (ATL-HPA041479) Datasheet (External Link)
Vendor Page Anti RBFA pAb (ATL-HPA041479)