Anti RBBP8NL pAb (ATL-HPA042627)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042627-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RBBP8NL
Alternative Gene Name: C20orf151, dJ908M14.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038980: 57%, ENSRNOG00000057245: 55%
Entrez Gene ID: 140893
Uniprot ID: Q8NC74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH |
| Gene Sequence | LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH |
| Gene ID - Mouse | ENSMUSG00000038980 |
| Gene ID - Rat | ENSRNOG00000057245 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBBP8NL pAb (ATL-HPA042627) | |
| Datasheet | Anti RBBP8NL pAb (ATL-HPA042627) Datasheet (External Link) |
| Vendor Page | Anti RBBP8NL pAb (ATL-HPA042627) at Atlas Antibodies |
| Documents & Links for Anti RBBP8NL pAb (ATL-HPA042627) | |
| Datasheet | Anti RBBP8NL pAb (ATL-HPA042627) Datasheet (External Link) |
| Vendor Page | Anti RBBP8NL pAb (ATL-HPA042627) |