Anti RBBP8NL pAb (ATL-HPA042627)

Atlas Antibodies

Catalog No.:
ATL-HPA042627-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RBBP8 N-terminal like
Gene Name: RBBP8NL
Alternative Gene Name: C20orf151, dJ908M14.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038980: 57%, ENSRNOG00000057245: 55%
Entrez Gene ID: 140893
Uniprot ID: Q8NC74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH
Gene Sequence LKAREAEAWEEPTELLGLPSALAGMQDLRLEGALHLLLAQQQLRARARAGSVRPRGQPTPGEMLPSLPVGSDSEGPENEGTRAALAAAGLSGGRH
Gene ID - Mouse ENSMUSG00000038980
Gene ID - Rat ENSRNOG00000057245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBBP8NL pAb (ATL-HPA042627)
Datasheet Anti RBBP8NL pAb (ATL-HPA042627) Datasheet (External Link)
Vendor Page Anti RBBP8NL pAb (ATL-HPA042627) at Atlas Antibodies

Documents & Links for Anti RBBP8NL pAb (ATL-HPA042627)
Datasheet Anti RBBP8NL pAb (ATL-HPA042627) Datasheet (External Link)
Vendor Page Anti RBBP8NL pAb (ATL-HPA042627)