Anti RBBP8 pAb (ATL-HPA039890)

Atlas Antibodies

Catalog No.: ATL-HPA039890-25

Protein Description: retinoblastoma binding protein 8
Gene Name: RBBP8
Alternative Gene Name: COM1, CtIP, RIM, SCKL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041238: 65%, ENSRNOG00000012899: 71%
Entrez Gene ID: 5932
Uniprot ID: Q99708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKS
• Gene Sequence: ELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKS
• Gene ID - Mouse: ENSMUSG00000041238
• Gene ID - Rat: ENSRNOG00000012899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBBP8 pAb (ATL-HPA039890) – 1 Found

Mijnes, Jolein; Veeck, Jürgen; Gaisa, Nadine T; Burghardt, Eduard; de Ruijter, Tim C; Gostek, Sonja; Dahl, Edgar; Pfister, David; Schmid, Sebastian C; Knüchel, Ruth; Rose, Michael. Promoter methylation of DNA damage repair (DDR) genes in human tumor entities: RBBP8/CtIP is almost exclusively methylated in bladder cancer. Clinical Epigenetics. 10( 29445424):15.