Anti RASSF1 pAb (ATL-HPA040735)

Atlas Antibodies

Catalog No.: ATL-HPA040735-25

Protein Description: Ras association (RalGDS/AF-6) domain family member 1
Gene Name: RASSF1
Alternative Gene Name: 123F2, NORE2A, RDA32, REH3P21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010067: 89%, ENSRNOG00000021548: 90%
Entrez Gene ID: 11186
Uniprot ID: Q9NS23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG
• Gene Sequence: KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG
• Gene ID - Mouse: ENSMUSG00000010067
• Gene ID - Rat: ENSRNOG00000021548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RASSF1 pAb (ATL-HPA040735) – 3 Found

Amato, Eliana; Barbi, Stefano; Fassan, Matteo; Luchini, Claudio; Vicentini, Caterina; Brunelli, Matteo; Malleo, Giuseppe; Scarpa, Aldo; Malpeli, Giorgio. RASSF1 tumor suppressor gene in pancreatic ductal adenocarcinoma: correlation of expression, chromosomal status and epigenetic changes. Bmc Cancer. 2016;16( 26754001):11. 

Chatzifrangkeskou, Maria; Pefani, Dafni-Eleftheria; Eyres, Michael; Vendrell, Iolanda; Fischer, Roman; Pankova, Daniela; O'Neill, Eric. RASSF1A is required for the maintenance of nuclear actin levels. The Embo Journal. 2019;38(16):e101168. 

Tsaridou, Stavroula; Velimezi, Georgia; Willenbrock, Frances; Chatzifrangkeskou, Maria; Elsayed, Waheba; Panagopoulos, Andreas; Karamitros, Dimitris; Gorgoulis, Vassilis; Lygerou, Zoi; Roukos, Vassilis; O'Neill, Eric; Pefani, Dafni Eleftheria. 53BP1-mediated recruitment of RASSF1A to ribosomal DNA breaks promotes local ATM signaling. Embo Reports. 2022;23(8):e54483.