Anti RASGRP1 pAb (ATL-HPA039389)

Atlas Antibodies

Catalog No.:
ATL-HPA039389-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS guanyl releasing protein 1
Gene Name: RASGRP1
Alternative Gene Name: CalDAG-GEFII, RASGRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027347: 85%, ENSRNOG00000005404: 82%
Entrez Gene ID: 10125
Uniprot ID: O95267
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD
Gene Sequence RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD
Gene ID - Mouse ENSMUSG00000027347
Gene ID - Rat ENSRNOG00000005404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASGRP1 pAb (ATL-HPA039389)
Datasheet Anti RASGRP1 pAb (ATL-HPA039389) Datasheet (External Link)
Vendor Page Anti RASGRP1 pAb (ATL-HPA039389) at Atlas Antibodies

Documents & Links for Anti RASGRP1 pAb (ATL-HPA039389)
Datasheet Anti RASGRP1 pAb (ATL-HPA039389) Datasheet (External Link)
Vendor Page Anti RASGRP1 pAb (ATL-HPA039389)