Anti RASAL1 pAb (ATL-HPA041650)

Atlas Antibodies

Catalog No.:
ATL-HPA041650-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS protein activator like 1 (GAP1 like)
Gene Name: RASAL1
Alternative Gene Name: RASAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029602: 71%, ENSRNOG00000001374: 70%
Entrez Gene ID: 8437
Uniprot ID: O95294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
Gene Sequence RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
Gene ID - Mouse ENSMUSG00000029602
Gene ID - Rat ENSRNOG00000001374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASAL1 pAb (ATL-HPA041650)
Datasheet Anti RASAL1 pAb (ATL-HPA041650) Datasheet (External Link)
Vendor Page Anti RASAL1 pAb (ATL-HPA041650) at Atlas Antibodies

Documents & Links for Anti RASAL1 pAb (ATL-HPA041650)
Datasheet Anti RASAL1 pAb (ATL-HPA041650) Datasheet (External Link)
Vendor Page Anti RASAL1 pAb (ATL-HPA041650)