Anti RASA4 pAb (ATL-HPA043010)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043010-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RASA4
Alternative Gene Name: CAPRI, GAPL, KIAA0538
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004952: 85%, ENSRNOG00000001431: 86%
Entrez Gene ID: 10156
Uniprot ID: O43374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKC |
| Gene Sequence | MSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKC |
| Gene ID - Mouse | ENSMUSG00000004952 |
| Gene ID - Rat | ENSRNOG00000001431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RASA4 pAb (ATL-HPA043010) | |
| Datasheet | Anti RASA4 pAb (ATL-HPA043010) Datasheet (External Link) |
| Vendor Page | Anti RASA4 pAb (ATL-HPA043010) at Atlas Antibodies |
| Documents & Links for Anti RASA4 pAb (ATL-HPA043010) | |
| Datasheet | Anti RASA4 pAb (ATL-HPA043010) Datasheet (External Link) |
| Vendor Page | Anti RASA4 pAb (ATL-HPA043010) |