Anti RASA4 pAb (ATL-HPA043010)

Atlas Antibodies

Catalog No.:
ATL-HPA043010-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS p21 protein activator 4
Gene Name: RASA4
Alternative Gene Name: CAPRI, GAPL, KIAA0538
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004952: 85%, ENSRNOG00000001431: 86%
Entrez Gene ID: 10156
Uniprot ID: O43374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKC
Gene Sequence MSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKC
Gene ID - Mouse ENSMUSG00000004952
Gene ID - Rat ENSRNOG00000001431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASA4 pAb (ATL-HPA043010)
Datasheet Anti RASA4 pAb (ATL-HPA043010) Datasheet (External Link)
Vendor Page Anti RASA4 pAb (ATL-HPA043010) at Atlas Antibodies

Documents & Links for Anti RASA4 pAb (ATL-HPA043010)
Datasheet Anti RASA4 pAb (ATL-HPA043010) Datasheet (External Link)
Vendor Page Anti RASA4 pAb (ATL-HPA043010)