Anti RASA2 pAb (ATL-HPA035375)

Atlas Antibodies

Catalog No.: ATL-HPA035375-25

Protein Description: RAS p21 protein activator 2
Gene Name: RASA2
Alternative Gene Name: GAP1M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032413: 82%, ENSRNOG00000011909: 82%
Entrez Gene ID: 5922
Uniprot ID: Q15283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGK
• Gene Sequence: SLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGK
• Gene ID - Mouse: ENSMUSG00000032413
• Gene ID - Rat: ENSRNOG00000011909
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RASA2 pAb (ATL-HPA035375) – 2 Found

Arafeh, Rand; Qutob, Nouar; Emmanuel, Rafi; Keren-Paz, Alona; Madore, Jason; Elkahloun, Abdel; Wilmott, James S; Gartner, Jared J; Di Pizio, Antonella; Winograd-Katz, Sabina; Sindiri, Sivasish; Rotkopf, Ron; Dutton-Regester, Ken; Johansson, Peter; Pritchard, Antonia L; Waddell, Nicola; Hill, Victoria K; Lin, Jimmy C; Hevroni, Yael; Rosenberg, Steven A; Khan, Javed; Ben-Dor, Shifra; Niv, Masha Y; Ulitsky, Igor; Mann, Graham J; Scolyer, Richard A; Hayward, Nicholas K; Samuels, Yardena. Recurrent inactivating RASA2 mutations in melanoma. Nature Genetics. 2015;47(12):1408-10. 

Carnevale, Julia; Shifrut, Eric; Kale, Nupura; Nyberg, William A; Blaeschke, Franziska; Chen, Yan Yi; Li, Zhongmei; Bapat, Sagar P; Diolaiti, Morgan E; O'Leary, Patrick; Vedova, Shane; Belk, Julia; Daniel, Bence; Roth, Theodore L; Bachl, Stefanie; Anido, Alejandro Allo; Prinzing, Brooke; Ibañez-Vega, Jorge; Lange, Shannon; Haydar, Dalia; Luetke-Eversloh, Marie; Born-Bony, Maelys; Hegde, Bindu; Kogan, Scott; Feuchtinger, Tobias; Okada, Hideho; Satpathy, Ansuman T; Shannon, Kevin; Gottschalk, Stephen; Eyquem, Justin; Krenciute, Giedre; Ashworth, Alan; Marson, Alexander. RASA2 ablation in T cells boosts antigen sensitivity and long-term function. Nature. 2022;609(7925):174-182.