Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035374-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RAS p21 protein activator 2
Gene Name: RASA2
Alternative Gene Name: GAP1M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032413: 86%, ENSRNOG00000011909: 86%
Entrez Gene ID: 5922
Uniprot ID: Q15283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
Gene Sequence PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
Gene ID - Mouse ENSMUSG00000032413
Gene ID - Rat ENSRNOG00000011909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation)
Datasheet Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation)
Datasheet Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASA2 pAb (ATL-HPA035374 w/enhanced validation)