Anti RARRES1 pAb (ATL-HPA003892)

Atlas Antibodies

Catalog No.: ATL-HPA003892-25

Protein Description: retinoic acid receptor responder (tazarotene induced) 1
Gene Name: RARRES1
Alternative Gene Name: LXNL, TIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049404: 73%, ENSRNOG00000037853: 78%
Entrez Gene ID: 5918
Uniprot ID: P49788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIW
• Gene Sequence: VVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIW
• Gene ID - Mouse: ENSMUSG00000049404
• Gene ID - Rat: ENSRNOG00000037853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RARRES1 pAb (ATL-HPA003892) – 3 Found

Roy, Arpita; Ramalinga, Malathi; Kim, Okjin J; Chijioke, Juliet; Lynch, Solomon; Byers, Stephen; Kumar, Deepak. Multiple roles of RARRES1 in prostate cancer: Autophagy induction and angiogenesis inhibition. Plos One. 12(7):e0180344. 

Patel, Jay; Xun, Dan; Creswell, Karen; Kim, Daniel K; Wu, Matthew; Hwang, Jung-Won; Kim, Taylor S; Bansal, Shivani; Hong, Sung-Hyeok; Galli, Susana; Kim, Hyun-Jung; Deng, Chuxia; Byers, Stephen W; Lee, Mi-Hye. Loss of RARRES1 function Promotes Follicular Lymphomagenesis and Inhibits B cell Differentiation in Mice. International Journal Of Biological Sciences. 18(7):2670-2682. 

Peterfi, Lehel; Banyai, Daniel; Yusenko, Maria V; Bjercke, Thea; Kovacs, Gyula. Expression of RARRES1 and AGBL2 and progression of conventional renal cell carcinoma. British Journal Of Cancer. 2020;122(12):1818-1824.