Anti RAPSN pAb (ATL-HPA039475)

Atlas Antibodies

Catalog No.: ATL-HPA039475-25

Protein Description: receptor-associated protein of the synapse
Gene Name: RAPSN
Alternative Gene Name: CMS1D, CMS1E, RNF205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111579: 94%, ENSRNOG00000011208: 95%
Entrez Gene ID: 5913
Uniprot ID: Q13702
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
• Gene Sequence: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
• Gene ID - Mouse: ENSMUSG00000111579
• Gene ID - Rat: ENSRNOG00000011208
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.