Anti RAPGEF3 pAb (ATL-HPA040365)

Atlas Antibodies

Catalog No.:
ATL-HPA040365-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Rap guanine nucleotide exchange factor (GEF) 3
Gene Name: RAPGEF3
Alternative Gene Name: bcm910, cAMP-GEFI, EPAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022469: 78%, ENSRNOG00000059961: 77%
Entrez Gene ID: 10411
Uniprot ID: O95398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNL
Gene Sequence LAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNL
Gene ID - Mouse ENSMUSG00000022469
Gene ID - Rat ENSRNOG00000059961
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAPGEF3 pAb (ATL-HPA040365)
Datasheet Anti RAPGEF3 pAb (ATL-HPA040365) Datasheet (External Link)
Vendor Page Anti RAPGEF3 pAb (ATL-HPA040365) at Atlas Antibodies

Documents & Links for Anti RAPGEF3 pAb (ATL-HPA040365)
Datasheet Anti RAPGEF3 pAb (ATL-HPA040365) Datasheet (External Link)
Vendor Page Anti RAPGEF3 pAb (ATL-HPA040365)