Anti RANBP6 pAb (ATL-HPA043748)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043748-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RANBP6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074909: 90%, ENSRNOG00000053859: 85%
Entrez Gene ID: 26953
Uniprot ID: O60518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYE |
| Gene Sequence | ATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYE |
| Gene ID - Mouse | ENSMUSG00000074909 |
| Gene ID - Rat | ENSRNOG00000053859 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RANBP6 pAb (ATL-HPA043748) | |
| Datasheet | Anti RANBP6 pAb (ATL-HPA043748) Datasheet (External Link) |
| Vendor Page | Anti RANBP6 pAb (ATL-HPA043748) at Atlas Antibodies |
| Documents & Links for Anti RANBP6 pAb (ATL-HPA043748) | |
| Datasheet | Anti RANBP6 pAb (ATL-HPA043748) Datasheet (External Link) |
| Vendor Page | Anti RANBP6 pAb (ATL-HPA043748) |