Anti RANBP2 pAb (ATL-HPA023960)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023960-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RANBP2
Alternative Gene Name: ADANE, ANE1, NUP358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 71%, ENSRNOG00000000796: 72%
Entrez Gene ID: 5903
Uniprot ID: P49792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNS |
| Gene Sequence | CGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNS |
| Gene ID - Mouse | ENSMUSG00000003226 |
| Gene ID - Rat | ENSRNOG00000000796 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RANBP2 pAb (ATL-HPA023960) | |
| Datasheet | Anti RANBP2 pAb (ATL-HPA023960) Datasheet (External Link) |
| Vendor Page | Anti RANBP2 pAb (ATL-HPA023960) at Atlas Antibodies |
| Documents & Links for Anti RANBP2 pAb (ATL-HPA023960) | |
| Datasheet | Anti RANBP2 pAb (ATL-HPA023960) Datasheet (External Link) |
| Vendor Page | Anti RANBP2 pAb (ATL-HPA023960) |
| Citations for Anti RANBP2 pAb (ATL-HPA023960) – 1 Found |
| Otsuka, Shotaro; Tempkin, Jeremy O B; Zhang, Wanlu; Politi, Antonio Z; Rybina, Arina; Hossain, M Julius; Kueblbeck, Moritz; Callegari, Andrea; Koch, Birgit; Morero, Natalia Rosalia; Sali, Andrej; Ellenberg, Jan. A quantitative map of nuclear pore assembly reveals two distinct mechanisms. Nature. 2023;613(7944):575-581. PubMed |