Anti RANBP2 pAb (ATL-HPA018437)

Atlas Antibodies

Catalog No.: ATL-HPA018437-25

Protein Description: RAN binding protein 2
Gene Name: RANBP2
Alternative Gene Name: ADANE, ANE1, NUP358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 75%, ENSRNOG00000000796: 77%
Entrez Gene ID: 5903
Uniprot ID: P49792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTL
• Gene Sequence: SNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTL
• Gene ID - Mouse: ENSMUSG00000003226
• Gene ID - Rat: ENSRNOG00000000796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RANBP2 pAb (ATL-HPA018437) – 1 Found

Otsuka, Shotaro; Bui, Khanh Huy; Schorb, Martin; Hossain, M Julius; Politi, Antonio Z; Koch, Birgit; Eltsov, Mikhail; Beck, Martin; Ellenberg, Jan. Nuclear pore assembly proceeds by an inside-out extrusion of the nuclear envelope. Elife. 2016;5( 27630123)