Anti RAD1 pAb (ATL-HPA006692)

Atlas Antibodies

Catalog No.: ATL-HPA006692-25

Protein Description: RAD1 checkpoint DNA exonuclease
Gene Name: RAD1
Alternative Gene Name: HRAD1, REC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022248: 91%, ENSRNOG00000018063: 91%
Entrez Gene ID: 5810
Uniprot ID: O60671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
• Gene Sequence: GLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
• Gene ID - Mouse: ENSMUSG00000022248
• Gene ID - Rat: ENSRNOG00000018063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.