Anti RACK1 pAb (ATL-HPA021676)

Atlas Antibodies

Catalog No.: ATL-HPA021676-100

Protein Description: receptor for activated C kinase 1
Gene Name: RACK1
Alternative Gene Name: Gnb2-rs1, GNB2L1, H12.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020372: 100%, ENSRNOG00000052620: 100%
Entrez Gene ID: 10399
Uniprot ID: P63244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
• Gene Sequence: CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
• Gene ID - Mouse: ENSMUSG00000020372
• Gene ID - Rat: ENSRNOG00000052620
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RACK1 pAb (ATL-HPA021676) – 1 Found

Otsuka, Motoyuki; Takata, Akemi; Yoshikawa, Takeshi; Kojima, Kentaro; Kishikawa, Takahiro; Shibata, Chikako; Takekawa, Mutsuhiro; Yoshida, Haruhiko; Omata, Masao; Koike, Kazuhiko. Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma. Plos One. 6(9):e24359.