Anti RABL3 pAb (ATL-HPA035151)

Atlas Antibodies

Catalog No.:
ATL-HPA035151-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAB, member of RAS oncogene family-like 3
Gene Name: RABL3
Alternative Gene Name: MGC23920
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022827: 86%, ENSRNOG00000026085: 86%
Entrez Gene ID: 285282
Uniprot ID: Q5HYI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
Gene Sequence LAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
Gene ID - Mouse ENSMUSG00000022827
Gene ID - Rat ENSRNOG00000026085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RABL3 pAb (ATL-HPA035151)
Datasheet Anti RABL3 pAb (ATL-HPA035151) Datasheet (External Link)
Vendor Page Anti RABL3 pAb (ATL-HPA035151) at Atlas Antibodies

Documents & Links for Anti RABL3 pAb (ATL-HPA035151)
Datasheet Anti RABL3 pAb (ATL-HPA035151) Datasheet (External Link)
Vendor Page Anti RABL3 pAb (ATL-HPA035151)