Anti RABIF pAb (ATL-HPA027715)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027715-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RABIF
Alternative Gene Name: mss4, RASGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042229: 90%, ENSRNOG00000045814: 90%
Entrez Gene ID: 5877
Uniprot ID: P47224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPD |
| Gene Sequence | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPD |
| Gene ID - Mouse | ENSMUSG00000042229 |
| Gene ID - Rat | ENSRNOG00000045814 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RABIF pAb (ATL-HPA027715) | |
| Datasheet | Anti RABIF pAb (ATL-HPA027715) Datasheet (External Link) |
| Vendor Page | Anti RABIF pAb (ATL-HPA027715) at Atlas Antibodies |
| Documents & Links for Anti RABIF pAb (ATL-HPA027715) | |
| Datasheet | Anti RABIF pAb (ATL-HPA027715) Datasheet (External Link) |
| Vendor Page | Anti RABIF pAb (ATL-HPA027715) |