Anti RABGAP1 pAb (ATL-HPA041651)

Atlas Antibodies

Catalog No.: ATL-HPA041651-25

Protein Description: RAB GTPase activating protein 1
Gene Name: RABGAP1
Alternative Gene Name: GAPCenA, TBC1D11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053164: 89%, ENSRNOG00000042269: 89%
Entrez Gene ID: 23637
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RICQQHTKDISERQARFSSQSGETGEVQACPDKRYAM
• Gene Sequence: RICQQHTKDISERQARFSSQSGETGEVQACPDKRYAM
• Gene ID - Mouse: ENSMUSG00000053164
• Gene ID - Rat: ENSRNOG00000042269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.