Anti RAB12 pAb (ATL-HPA040727)

Atlas Antibodies

Catalog No.: ATL-HPA040727-25

Protein Description: RAB12, member RAS oncogene family
Gene Name: RAB12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023460: 98%, ENSRNOG00000019295: 98%
Entrez Gene ID: 201475
Uniprot ID: Q6IQ22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASA
• Gene Sequence: ITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASA
• Gene ID - Mouse: ENSMUSG00000023460
• Gene ID - Rat: ENSRNOG00000019295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.