Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036406-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RAB11FIP5
Alternative Gene Name: GAF1, KIAA0857, pp75, RIP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051343: 69%, ENSRNOG00000056009: 73%
Entrez Gene ID: 26056
Uniprot ID: Q9BXF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP |
| Gene Sequence | LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP |
| Gene ID - Mouse | ENSMUSG00000051343 |
| Gene ID - Rat | ENSRNOG00000056009 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) | |
| Datasheet | Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) | |
| Datasheet | Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation) |