Anti RAB11FIP5 pAb (ATL-HPA036406 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036406-25

Protein Description: RAB11 family interacting protein 5 (class I)
Gene Name: RAB11FIP5
Alternative Gene Name: GAF1, KIAA0857, pp75, RIP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051343: 69%, ENSRNOG00000056009: 73%
Entrez Gene ID: 26056
Uniprot ID: Q9BXF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP
• Gene Sequence: LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP
• Gene ID - Mouse: ENSMUSG00000051343
• Gene ID - Rat: ENSRNOG00000056009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.