Anti RAB11FIP3 pAb (ATL-HPA028631)

Atlas Antibodies

Catalog No.: ATL-HPA028631-25

Protein Description: RAB11 family interacting protein 3 (class II)
Gene Name: RAB11FIP3
Alternative Gene Name: eferin, KIAA0665, Rab11-FIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038524: 35%, ENSRNOG00000039415: 34%
Entrez Gene ID: 9727
Uniprot ID: O75154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ
• Gene Sequence: PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ
• Gene ID - Mouse: ENSMUSG00000038524
• Gene ID - Rat: ENSRNOG00000039415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAB11FIP3 pAb (ATL-HPA028631) – 1 Found

Atilla-Gokcumen, G Ekin; Muro, Eleonora; Relat-Goberna, Josep; Sasse, Sofia; Bedigian, Anne; Coughlin, Margaret L; Garcia-Manyes, Sergi; Eggert, Ulrike S. Dividing cells regulate their lipid composition and localization. Cell. 2014;156(3):428-39.