Anti RAB11FIP2 pAb (ATL-HPA037726)

Atlas Antibodies

Catalog No.: ATL-HPA037726-25

Protein Description: RAB11 family interacting protein 2 (class I)
Gene Name: RAB11FIP2
Alternative Gene Name: KIAA0941, nRip11, Rab11-FIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040022: 86%, ENSRNOG00000009523: 86%
Entrez Gene ID: 22841
Uniprot ID: Q7L804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN
• Gene Sequence: HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN
• Gene ID - Mouse: ENSMUSG00000040022
• Gene ID - Rat: ENSRNOG00000009523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAB11FIP2 pAb (ATL-HPA037726) – 2 Found

Schafer, Jenny C; McRae, Rebecca E; Manning, Elizabeth H; Lapierre, Lynne A; Goldenring, James R. Rab11-FIP1A regulates early trafficking into the recycling endosomes. Experimental Cell Research. 2016;340(2):259-73. 

Schafer, Jenny C; Baetz, Nicholas W; Lapierre, Lynne A; McRae, Rebecca E; Roland, Joseph T; Goldenring, James R. Rab11-FIP2 interaction with MYO5B regulates movement of Rab11a-containing recycling vesicles. Traffic (Copenhagen, Denmark). 2014;15(3):292-308.