Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023904-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RAB11FIP1
Alternative Gene Name: FLJ22524, FLJ22622, Rab11-FIP1, RCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031488: 84%, ENSRNOG00000058940: 84%
Entrez Gene ID: 80223
Uniprot ID: Q6WKZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR |
| Gene Sequence | TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR |
| Gene ID - Mouse | ENSMUSG00000031488 |
| Gene ID - Rat | ENSRNOG00000058940 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) | |
| Datasheet | Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) | |
| Datasheet | Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) |
| Citations for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) – 1 Found |
| Hong, Sung Pil; Chan, Thalia E; Lombardo, Ylenia; Corleone, Giacomo; Rotmensz, Nicole; Bravaccini, Sara; Rocca, Andrea; Pruneri, Giancarlo; McEwen, Kirsten R; Coombes, R Charles; Barozzi, Iros; Magnani, Luca. Single-cell transcriptomics reveals multi-step adaptations to endocrine therapy. Nature Communications. 2019;10(1):3840. PubMed |