Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023904-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAB11 family interacting protein 1 (class I)
Gene Name: RAB11FIP1
Alternative Gene Name: FLJ22524, FLJ22622, Rab11-FIP1, RCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031488: 84%, ENSRNOG00000058940: 84%
Entrez Gene ID: 80223
Uniprot ID: Q6WKZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR
Gene Sequence TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR
Gene ID - Mouse ENSMUSG00000031488
Gene ID - Rat ENSRNOG00000058940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation)
Datasheet Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation)
Datasheet Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation)
Citations for Anti RAB11FIP1 pAb (ATL-HPA023904 w/enhanced validation) – 1 Found
Hong, Sung Pil; Chan, Thalia E; Lombardo, Ylenia; Corleone, Giacomo; Rotmensz, Nicole; Bravaccini, Sara; Rocca, Andrea; Pruneri, Giancarlo; McEwen, Kirsten R; Coombes, R Charles; Barozzi, Iros; Magnani, Luca. Single-cell transcriptomics reveals multi-step adaptations to endocrine therapy. Nature Communications. 2019;10(1):3840.  PubMed