Anti R3HDM2 pAb (ATL-HPA038327)

Atlas Antibodies

Catalog No.: ATL-HPA038327-25

Protein Description: R3H domain containing 2
Gene Name: R3HDM2
Alternative Gene Name: KIAA1002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025404: 92%, ENSRNOG00000007801: 89%
Entrez Gene ID: 22864
Uniprot ID: Q9Y2K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSGVSPSGPGVVVMQLNVPNGPQPPQNPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSP
• Gene Sequence: YSGVSPSGPGVVVMQLNVPNGPQPPQNPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSP
• Gene ID - Mouse: ENSMUSG00000025404
• Gene ID - Rat: ENSRNOG00000007801
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.