Anti PZP pAb (ATL-HPA041471)

Atlas Antibodies

Catalog No.:
ATL-HPA041471-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pregnancy-zone protein
Gene Name: PZP
Alternative Gene Name: CPAMD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030111: 51%, ENSRNOG00000045772: 48%
Entrez Gene ID: 5858
Uniprot ID: P20742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGL
Gene Sequence VSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGL
Gene ID - Mouse ENSMUSG00000030111
Gene ID - Rat ENSRNOG00000045772
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PZP pAb (ATL-HPA041471)
Datasheet Anti PZP pAb (ATL-HPA041471) Datasheet (External Link)
Vendor Page Anti PZP pAb (ATL-HPA041471) at Atlas Antibodies

Documents & Links for Anti PZP pAb (ATL-HPA041471)
Datasheet Anti PZP pAb (ATL-HPA041471) Datasheet (External Link)
Vendor Page Anti PZP pAb (ATL-HPA041471)