Anti PYURF pAb (ATL-HPA036455)

Atlas Antibodies

Catalog No.:
ATL-HPA036455-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: PIGY upstream reading frame
Gene Name: PYURF
Alternative Gene Name: PreY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043162: 72%, ENSRNOG00000006858: 74%
Entrez Gene ID: 100996939
Uniprot ID: Q96I23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR
Gene Sequence VARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR
Gene ID - Mouse ENSMUSG00000043162
Gene ID - Rat ENSRNOG00000006858
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PYURF pAb (ATL-HPA036455)
Datasheet Anti PYURF pAb (ATL-HPA036455) Datasheet (External Link)
Vendor Page Anti PYURF pAb (ATL-HPA036455) at Atlas Antibodies

Documents & Links for Anti PYURF pAb (ATL-HPA036455)
Datasheet Anti PYURF pAb (ATL-HPA036455) Datasheet (External Link)
Vendor Page Anti PYURF pAb (ATL-HPA036455)