Anti PYURF pAb (ATL-HPA036455)

Atlas Antibodies

Catalog No.: ATL-HPA036455-100

Protein Description: PIGY upstream reading frame
Gene Name: PYURF
Alternative Gene Name: PreY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043162: 72%, ENSRNOG00000006858: 74%
Entrez Gene ID: 100996939
Uniprot ID: Q96I23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR
• Gene Sequence: VARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR
• Gene ID - Mouse: ENSMUSG00000043162
• Gene ID - Rat: ENSRNOG00000006858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.