Anti PYGL pAb (ATL-HPA000962 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000962-25

Protein Description: phosphorylase, glycogen, liver
Gene Name: PYGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021069: 94%, ENSRNOG00000006388: 92%
Entrez Gene ID: 5836
Uniprot ID: P06737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
• Gene Sequence: MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
• Gene ID - Mouse: ENSMUSG00000021069
• Gene ID - Rat: ENSRNOG00000006388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PYGL pAb (ATL-HPA000962 w/enhanced validation) – 4 Found

Johanns, M; Lai, Y-C; Hsu, M-F; Jacobs, R; Vertommen, D; Van Sande, J; Dumont, J E; Woods, A; Carling, D; Hue, L; Viollet, B; Foretz, M; Rider, M H. AMPK antagonizes hepatic glucagon-stimulated cyclic AMP signalling via phosphorylation-induced activation of cyclic nucleotide phosphodiesterase 4B. Nature Communications. 2016;7( 26952277):10856. 

García-Consuegra, Inés; Asensio-Peña, Sara; Garrido-Moraga, Rocío; Pinós, Tomàs; Domínguez-González, Cristina; Santalla, Alfredo; Nogales-Gadea, Gisela; Serrano-Lorenzo, Pablo; Andreu, Antoni L; Arenas, Joaquín; Zugaza, José L; Lucia, Alejandro; Martín, Miguel A. Identification of Potential Muscle Biomarkers in McArdle Disease: Insights from Muscle Proteome Analysis. International Journal Of Molecular Sciences. 2022;23(9) 

Zois, Christos E; Hendriks, Anne M; Haider, Syed; Pires, Elisabete; Bridges, Esther; Kalamida, Dimitra; Voukantsis, Dimitrios; Lagerholm, B Christoffer; Fehrmann, Rudolf S N; den Dunnen, Wilfred F A; Tarasov, Andrei I; Baba, Otto; Morris, John; Buffa, Francesca M; McCullagh, James S O; Jalving, Mathilde; Harris, Adrian L. Liver glycogen phosphorylase is upregulated in glioblastoma and provides a metabolic vulnerability to high dose radiation. Cell Death & Disease. 2022;13(6):573. 

Nogales-Gadea, Gisela; Mormeneo, Emma; García-Consuegra, Inés; Rubio, Juan C; Orozco, Anna; Arenas, Joaquin; Martín, Miguel A; Lucia, Alejandro; Gómez-Foix, Anna M; Martí, Ramon; Andreu, Antoni L. Expression of glycogen phosphorylase isoforms in cultured muscle from patients with McArdle's disease carrying the p.R771PfsX33 PYGM mutation. Plos One. 2010;5(10)