Anti PUSL1 pAb (ATL-HPA032057)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032057-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PUSL1
Alternative Gene Name: FLJ90811
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051557: 80%, ENSRNOG00000022354: 78%
Entrez Gene ID: 126789
Uniprot ID: Q8N0Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLY |
| Gene Sequence | WTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLY |
| Gene ID - Mouse | ENSMUSG00000051557 |
| Gene ID - Rat | ENSRNOG00000022354 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PUSL1 pAb (ATL-HPA032057) | |
| Datasheet | Anti PUSL1 pAb (ATL-HPA032057) Datasheet (External Link) |
| Vendor Page | Anti PUSL1 pAb (ATL-HPA032057) at Atlas Antibodies |
| Documents & Links for Anti PUSL1 pAb (ATL-HPA032057) | |
| Datasheet | Anti PUSL1 pAb (ATL-HPA032057) Datasheet (External Link) |
| Vendor Page | Anti PUSL1 pAb (ATL-HPA032057) |
| Citations for Anti PUSL1 pAb (ATL-HPA032057) – 1 Found |
| Busch, Jakob D; Cipullo, Miriam; Atanassov, Ilian; Bratic, Ana; Silva Ramos, Eduardo; Schöndorf, Thomas; Li, Xinping; Pearce, Sarah F; Milenkovic, Dusanka; Rorbach, Joanna; Larsson, Nils-Göran. MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition. Cell Reports. 2019;29(6):1728-1738.e9. PubMed |