Anti PUS3 pAb (ATL-HPA038040)

Atlas Antibodies

Catalog No.:
ATL-HPA038040-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pseudouridylate synthase 3
Gene Name: PUS3
Alternative Gene Name: FKSG32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032103: 94%, ENSRNOG00000012994: 90%
Entrez Gene ID: 83480
Uniprot ID: Q9BZE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLN
Gene Sequence NLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLN
Gene ID - Mouse ENSMUSG00000032103
Gene ID - Rat ENSRNOG00000012994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PUS3 pAb (ATL-HPA038040)
Datasheet Anti PUS3 pAb (ATL-HPA038040) Datasheet (External Link)
Vendor Page Anti PUS3 pAb (ATL-HPA038040) at Atlas Antibodies

Documents & Links for Anti PUS3 pAb (ATL-HPA038040)
Datasheet Anti PUS3 pAb (ATL-HPA038040) Datasheet (External Link)
Vendor Page Anti PUS3 pAb (ATL-HPA038040)